Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTryptophan 5-monooxygenase 1
LigandBDBM341653
Substrate/Competitorn/a
Meas. Tech.Biochemical In Vitro Assay
IC50 5.00±n/a nM
Citation Bur, DGrisostomi, CNayler, ORemen, LVercauteren, MWelford, R Tricyclic piperidine compounds US Patent US9765092 Publication Date 9/19/2017
More Info.:Get all data from this article,  Assay Method
 
Tryptophan 5-monooxygenase 1
Name:Tryptophan 5-hydroxylase_UNCURATED
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:50990.64
Organism:Homo sapiens (Human)
Description:ChEMBL_1361824
Residue:444
Sequence:
MIEDNKENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEF
EIFVDCDINREQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDHCAN
RVLMYGSELDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQE
LNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRD
FLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGA
SEEAVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKITC
KQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSA
MNELQHDLDVVSDALAKVSRKPSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM341653
NameBDBM341653
Synonyms:6-chloro-5-(2-(5-(5-(dimethylcarbamoyl)-3-fluoro-thiophen-2-yl)-7,8-dihydrothiazolo[2',3':2,3]imidazo-[4,5-c]pyridin-6(5H)-yl)-2-oxoethoxy)-N,N-dimethylpicolinamide | US9765092, Example 6.9.2
TypeSmall organic molecule
Emp. Form.C25H24ClFN6O4S2
Mol. Mass.591.077
SMILESCN(C)C(=O)c1cc(F)c(s1)C1N(CCc2nc3sccn3c12)C(=O)COc1ccc(nc1Cl)C(=O)N(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a