Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLarge neutral amino acids transporter small subunit 2
LigandBDBM340651
Substrate/Competitorn/a
IC50 258000±n/a nM
Citation Kanai, YNagamori, SKitaura, YNeya, MMatsushita, N Phenoxyalkylamine compound US Patent US9771316 Publication Date 9/26/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Large neutral amino acids transporter small subunit 2
Name:Large neutral amino acids transporter small subunit 2
Synonyms:n/a
Type:Protein
Mol. Mass.:58378.41
Organism:Homo sapiens (Human)
Description:Q9UHI5
Residue:535
Sequence:
MEEGARHRNNTEKKHPGGGESDASPEAGSGGGGVALKKEIGLVSACGIIVGNIIGSGIFV
SPKGVLENAGSVGLALIVWIVTGFITVVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGF
LRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSV
RWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPKNAFENFQEPDIGLVALAFLQ
GSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANVAYVTAMSPQELLASN
AVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVK
RCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPI
KINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFSDFI
ELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM340651
NameBDBM340651
Synonyms:US9771316, Example 53
TypeSmall organic molecule
Emp. Form.C16H17F4NO2S
Mol. Mass.363.37
SMILESNCCCCC(Oc1ccc(OC(F)(F)F)c(F)c1)c1cccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a