Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKetohexokinase
LigandBDBM8366
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
IC50 30.0±n/a nM
Citation Zhang, XAbad, MCGibbs, ACKuo, GSong, FSui, ZKuo, LC Indazole compounds useful as ketohexokinase inhibitors US Patent US9771375 Publication Date 9/26/2017
More Info.:Get all data from this article,  Assay Method
 
Ketohexokinase
Name:Ketohexokinase
Synonyms:Hepatic fructokinase | Ketohexokinase (KHK)
Type:Enzyme
Mol. Mass.:32521.64
Organism:Homo sapiens (Human)
Description:P50053
Residue:298
Sequence:
MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM
GSMAPGHVADFLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV
SATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELF
QLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8366
NameBDBM8366
Synonyms:CHEMBL1809169 | US8822448, 147 | US9771375, Example 147
Typen/a
Emp. Form.C20H21N3S
Mol. Mass.335.466
SMILESCSc1nn(-c2cccc(C)c2)c2cc(ccc12)C1=CCNCC1 |t:21|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a