Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKetohexokinase
LigandBDBM130649
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
IC50>10000±n/a nM
Citation Zhang, XAbad, MCGibbs, ACKuo, GSong, FSui, ZKuo, LC Indazole compounds useful as ketohexokinase inhibitors US Patent US9771375 Publication Date 9/26/2017
More Info.:Get all data from this article,  Assay Method
 
Ketohexokinase
Name:Ketohexokinase
Synonyms:Hepatic fructokinase | Ketohexokinase (KHK)
Type:Enzyme
Mol. Mass.:32521.64
Organism:Homo sapiens (Human)
Description:P50053
Residue:298
Sequence:
MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM
GSMAPGHVADFLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV
SATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELF
QLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM130649
NameBDBM130649
Synonyms:US8822447, 154 | US9771375, Example 154
TypeSmall organic molecule
Emp. Form.C21H17N3S
Mol. Mass.343.445
SMILESCSc1nn(-c2ccccc2)c2cc(C=Cc3ccncc3)ccc12 |w:14.14|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a