Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase SYK
LigandBDBM339985
Substrate/Competitorn/a
Meas. Tech.Homogeneous Time-Resolved Fluorescence (HTRF) Assay
IC50 3.1±n/a nM
Citation Altman, MDCash, BEllis, JMMaddess, MLNorthrup, ABOtte, RDSun, B 2-pyrazine carboxamides as spleen tyrosine kinase inhibitors US Patent US9775839 Publication Date 10/3/2017
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase SYK
Name:Tyrosine-protein kinase SYK
Synonyms:Lysyl-tRNA synthetase | SYK | Spleen Tyrosine Kinase | Spleen tyrosine kinase (SYK) | Tyrosine-protein kinase SYK (Syk)
Type:Enzyme
Mol. Mass.:72079.99
Organism:Homo sapiens (Human)
Description:P43405
Residue:635
Sequence:
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM339985
NameBDBM339985
Synonyms:5-{[(3S,4S)-4-amino-1,1- dioxidotetrahydro-2H- thiopyran-3-yl]amino}-3- (5-fluoro-1H-indol-2- yl)pyrazine-2- carboxamide | US9775839, 7.9
TypeSmall organic molecule
Emp. Form.C18H19FN6O3S
Mol. Mass.418.445
SMILESN[C@H]1CCS(=O)(=O)C[C@H]1Nc1cnc(C(N)=O)c(n1)-c1cc2cc(F)ccc2[nH]1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a