Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPRMT5/MEP50 Enzyme
LigandBDBM343916
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
IC50<100±n/a nM
Citation Duncan, KWChesworth, RMunchhof, MJJin, L PRMT5 inhibitors and uses thereof US Patent US9777008 Publication Date 10/3/2017
More Info.:Get all data from this article,  Assay Method
 
PRMT5/MEP50 Enzyme
Name:PRMT5/MEP50 Enzyme
Synonyms:PRMT5/MEP50 | PRMT5/MEP50 complex
Type:Protein
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:PRMT5/MEP50 complex
Synonyms:72 kDa ICln-binding protein | HRMT1L5 | Histone-arginine N-methyltransferase PRMT5 | IBP72 | JBP1 | Jak-binding protein 1 | PRMT5 | PRMT5/MEP50 complex | Protein arginine N-methyltransferase 5 (PRMT5) | Protein arginine methyltransferase 5 (PRMT5) | SKB1 | SKB1 homolog | SKB1Hs | Shk1 kinase-binding protein 1 homolog
Type:Enzyme
Mol. Mass.:72679.99
Organism:Homo sapiens (Human)
Description:O14744
Residue:637
Sequence:
MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAK
NRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLP
AFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYS
GEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNK
KGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELF
AKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV
LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM
REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKL
YNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEF
PVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICV
RFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:PRMT5/MEP50 complex
Synonyms:Androgen receptor cofactor p44 | MEP-50 | MEP50 | Methylosome protein 50 | Nbla10071 | WD repeat-containing protein 77 | WD45 | WDR77 | p44/Mep50
Type:Enzyme
Mol. Mass.:36713.38
Organism:Homo sapiens (Human)
Description:Q9BQA1
Residue:342
Sequence:
MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWL
FKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFC
KYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKD
SVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLV
DTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFV
RDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM343916
NameBDBM343916
Synonyms:1-(3,4-dihydroisoquinolin-2(1H)-yl)-3-(3-(2-methyl-2H-pyrazolo[3,4-b]pyridin-6-yl)phenoxy)propan-2-ol | US9777008, Compound 210
TypeSmall organic molecule
Emp. Form.C25H26N4O2
Mol. Mass.414.4995
SMILESCn1cc2ccc(nc2n1)-c1cccc(OCC(O)CN2CCc3ccccc3C2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a