Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase Type 4 (PDE4B)
LigandBDBM14776
Substrate/CompetitorBDBM10851
Meas. Tech.Phosphodiesterase (PDE) Inhibition Assay
IC50 3800±n/a nM
Citation Card, GLEngland, BPSuzuki, YFong, DPowell, BLee, BLuu, CTabrizizad, MGillette, SIbrahim, PNArtis, DRBollag, GMilburn, MVKim, SHSchlessinger, JZhang, KY Structural basis for the activity of drugs that inhibit phosphodiesterases. Structure12:2233-47 (2004) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Phosphodiesterase Type 4 (PDE4B)
Name:Phosphodiesterase Type 4 (PDE4B)
Synonyms:DPDE4 | PDE32 | cAMP-specific 3,5-cyclic phosphodiesterase 4B
Type:Enzyme Catalytic Domain
Mol. Mass.:45579.64
Organism:Homo sapiens (Human)
Description:RECOMBINANT CATALYTIC DOMAIN OF HUMAN PHOSPHODIESTERASE 4B.
Residue:398
Sequence:
MGSSHHHHHHSSGLVPRGSHMSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNR
PLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHVLL
STPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAV
GFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSG
VLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISP
MCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSPSP
PLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14776
NameBDBM14776
Synonyms:2-{2-ethoxy-5-[(4-ethylpiperazine-1-)sulfonyl]phenyl}-5-methyl-7-propyl-3H,4H-imidazo[1,5-a][1,2,4]triazin-4-one | CHEMBL1520 | VARDENAFIL | Vardenafil | citric acid;2-[2-ethoxy-5-(4-ethylpiperazino)sulfonyl-phenyl]-5-methyl-7-propyl-1H-imidazo[5,1-f][1,2,4]triazin-4-one | vardenafil
TypeSmall organic molecule
Emp. Form.C23H32N6O4S
Mol. Mass.488.603
SMILESCCCc1nc(C)c2n1nc([nH]c2=O)-c1cc(ccc1OCC)S(=O)(=O)N1CCN(CC)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM10851
NameBDBM10851
Synonyms:(4aR,6R,7R,7aS)-6-(6-amino-9H-purin-9-yl)-2,7-dihydroxy-hexahydro-1,3,5,2-furo[3,2-d][1,3,2]dioxaphosphinin-2-one | (4aR,6R,7R,7aS)-6-(6-amino-9H-purin-9-yl)tetrahydro-4H-furo[3,2-d][1,3,2]dioxaphosphinine-2,7-diol 2-oxide | ADENOSINE-3 ,5 -CYCLIC-MONOPHOSPHATE | Cyclic adenosine monophosphate | cAMP | cid_23902375
TypeSmall organic molecule
Emp. Form.C10H12N5O6P
Mol. Mass.329.2059
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@@H]2COP(O)(=O)O[C@H]2[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: