Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMast/stem cell growth factor receptor Kit
LigandBDBM346017
Substrate/Competitorn/a
Meas. Tech.In Vitro TK Inhibition Assay
EC50<1000±n/a nM
Citation Moussy, ABenjahad, ASchalon, CPez, DChevenier, ESandrinelli, FMartin, JPicoul, W Benzimidazole derivatives as selective proteine kinase inhibitors US Patent US10202370 Publication Date 2/12/2019
More Info.:Get all data from this article,  Assay Method
 
Mast/stem cell growth factor receptor Kit
Name:Mast/stem cell growth factor receptor Kit
Synonyms:CD117 antigen | CD_antigen=CD117 | KIT | Mast/stem cell growth factor receptor Kit (cKIT) | Proto-oncogene c-Kit | Proto-oncogene tyrosine-protein kinase Kit | SCFR | Stem cell growth factor receptor | Tyrosine Kinase c-Kit | Tyrosine-protein kinase Kit | Tyrosine-protein kinase Kit (c-Kit) | c-kit | p-145 c-kit | v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Type:Protein
Mol. Mass.:109869.37
Organism:Homo sapiens (Human)
Description:P10721
Residue:976
Sequence:
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH
RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE
DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR
LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS
SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV
MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC
TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE
YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM
AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES
IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV
GSTASSSQPLLVHDDV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM346017
NameBDBM346017
Synonyms:3-[5-Methyl-6-(4- pyridin-3-yl-thiazol- 2-ylamino)-1H- benzoimidazol-2-yl]- benzonitrile | US10202370, Example 010
TypeSmall organic molecule
Emp. Form.C23H16N6S
Mol. Mass.408.478
SMILESCc1cc2nc([nH]c2cc1Nc1nc(cs1)-c1cccnc1)-c1cccc(c1)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a