Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase Type 9 (PDE9A)
LigandBDBM14774
Substrate/CompetitorBDBM14391
Meas. Tech.PDE9A Inhibition Assay
pH7.5±n/a
Temperature303.15±n/a K
IC50>200000±n/a nM
Citation Card, GLEngland, BPSuzuki, YFong, DPowell, BLee, BLuu, CTabrizizad, MGillette, SIbrahim, PNArtis, DRBollag, GMilburn, MVKim, SHSchlessinger, JZhang, KY Structural basis for the activity of drugs that inhibit phosphodiesterases. Structure12:2233-47 (2004) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Phosphodiesterase Type 9 (PDE9A)
Name:Phosphodiesterase Type 9 (PDE9A)
Synonyms:High-affinity cGMP-specific 3,5-cyclic phosphodiesterase 9A | PDE9A
Type:Enzyme Catalytic Domain
Mol. Mass.:43183.20
Organism:Homo sapiens (human)
Description:Recombinant catalytic domain (S226-A593) of human PDE9A.
Residue:368
Sequence:
SFLDNHKKLTPRRDVPTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLV
RDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILIL
MTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIP
PDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISN
EVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMF
ETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDV
KNSEGDCA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14774
NameBDBM14774
Synonyms:3-(cyclopropylmethoxy)-N-(3,5-dichloropyridin-4-yl)-4-(difluoromethoxy)benzamide | CHEMBL193240 | DAXAS | ROF | Roflumilast
TypeSmall organic molecule
Emp. Form.C17H14Cl2F2N2O3
Mol. Mass.403.207
SMILESFC(F)Oc1ccc(cc1OCC1CC1)C(=O)Nc1c(Cl)cncc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM14391
NameBDBM14391
Synonyms:2-amino-9-[(4aR,6R,7R,7aS)-2,7-dihydroxy-2-oxidotetrahydro-4H-furo[3,2-d][1,3,2]dioxaphosphinin-6-yl]-1,9-dihydro-6H-purin-6-one | 9-[(4aR,6R,7R,7aS)-2,7-dihydroxy-2-oxo-hexahydro-1,3,5,2-furo[3,2-d][1,3,2]dioxaphosphinin-6-yl]-2-amino-6,9-dihydro-1H-purin-6-one | GUANOSINE-3 ,5 -MONOPHOSPHATE | cGMP
TypeNucleoside or nucleotide
Emp. Form.C10H12N5O7P
Mol. Mass.345.2053
SMILESNc1nc2n(cnc2c(=O)[nH]1)[C@@H]1O[C@@H]2COP(O)(=O)O[C@H]2[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: