Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphatidylinositol 3-kinase catalytic subunit type 3
LigandBDBM346199
Substrate/Competitorn/a
Meas. Tech.Human VPS34 Enzyme Assay
IC50 30±n/a nM
Citation Bharathan, ITBlackburn, CCiavarri, JPChouitar, JCullis, CAD Amore, NFleming, PEGigstad, KMGipson, KEGirard, MHu, YLee, JLi, GRezaei, MSintchak, MDSoucy, FStroud, SGVos, TJXu, HYe, Y Heteroaryls and uses thereof US Patent US10202373 Publication Date 2/12/2019
More Info.:Get all data from this article,  Assay Method
 
Phosphatidylinositol 3-kinase catalytic subunit type 3
Name:Phosphatidylinositol 3-kinase catalytic subunit type 3
Synonyms:BC033004 | PI3K type 3 | Phosphatidylinositol 3-kinase catalytic subunit type 3 (PIK3C3) | Phosphatidylinositol 3-kinase p100 subunit | Phosphoinositide 3-Kinase (PI3K), Vps34 | Phosphoinositide-3-kinase class 3 | PtdIns-3-kinase type 3 | hVPS34
Type:Enzyme
Mol. Mass.:101551.30
Organism:Homo sapiens (Human)
Description:Recombinant human Vps34 protein was expressed as monomeric GST-fusion and purified.
Residue:887
Sequence:
MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVT
CQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAV
PVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTK
AHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDG
DESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIV
SYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDV
EDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKK
DSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLI
SRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRS
LLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVK
IRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRK
ENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAE
VMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLN
KEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVK
KVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM346199
NameBDBM346199
Synonyms:US10202373, Compound I-11 | US10202373, Example 3C
TypeSmall organic molecule
Emp. Form.C21H16F2N4O3S
Mol. Mass.442.439
SMILESCC(=O)Nc1cc(ccn1)-c1cnc(C)c2n(ccc12)S(=O)(=O)c1ccc(F)cc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a