Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUbiquitin carboxyl-terminal hydrolase isozyme L5
LigandBDBM50442907
Substrate/Competitorn/a
Meas. Tech.Fluorometric Ub-AMC Hydrolysis Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50 36500±n/a nM
Commentsextracted
Citation Ott, CABaljinnyam, BZakharov, AVJadhav, ASimeonov, AZhuang, Z Cell Lysate-Based AlphaLISA Deubiquitinase Assay Platform for Identification of Small Molecule Inhibitors. ACS Chem Biol12:2399-2407 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ubiquitin carboxyl-terminal hydrolase isozyme L5
Name:Ubiquitin carboxyl-terminal hydrolase isozyme L5
Synonyms:CGI-70 | UCH-L5 | UCH37 | UCHL5 | Ubiquitin C-terminal hydrolase UCH37 | Ubiquitin carboxyl-terminal hydrolase isozyme L5 | Ubiquitin thioesterase L5
Type:PROTEIN
Mol. Mass.:37597.89
Organism:Homo sapiens (Human)
Description:ChEMBL_109575
Residue:329
Sequence:
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELL
KTLAEHQQLIPLVEKAKEKQNAKKAQETK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50442907
NameBDBM50442907
Synonyms:Acetyl Isogambogic Acid | CHEMBL3039433
TypeSmall organic molecule
Emp. Form.C40H46O9
Mol. Mass.670.7878
SMILES[H]C12[#6]-[#6@H]-3-[#6]=[#6]4-[#6](=O)-c5c(-[#8]-[#6](-[#6])=O)c6-[#6]=[#6]C([#6])([#6]-[#6]\[#6]=[#6](\[#6])-[#6])[#8]-c6c(-[#6]\[#6]=[#6](\[#6])-[#6])c5-[#8][C@@]14C([#6]\[#6]=[#6](/[#6])-[#6](-[#8])=O)([#8]C2([#6])[#6])[#6]-3=O |r,c:15,t:4,TLB:34:35:44.45:48.3.2,4:3:35:44.45,THB:5:35:44.45:48.3.2,49:48:35:44.45,45:1:5.4:36.48|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a