Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUbiquitin carboxyl-terminal hydrolase 15
LigandBDBM65524
Substrate/Competitorn/a
Meas. Tech.Fluorometric Ub-AMC Hydrolysis Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50>114000±n/a nM
Commentsextracted
Citation Ott, CABaljinnyam, BZakharov, AVJadhav, ASimeonov, AZhuang, Z Cell Lysate-Based AlphaLISA Deubiquitinase Assay Platform for Identification of Small Molecule Inhibitors. ACS Chem Biol12:2399-2407 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ubiquitin carboxyl-terminal hydrolase 15
Name:Ubiquitin carboxyl-terminal hydrolase 15
Synonyms:Deubiquitinating enzyme 15 | Ubiquitin thioesterase 15 | Ubiquitin-specific-processing protease 15 | Unph-2 | Unph4
Type:Protein
Mol. Mass.:112388.07
Organism:Homo sapiens (Human)
Description:Q9Y4E8
Residue:981
Sequence:
MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLW
NKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKSPGASNFSTLPK
ISPSSLSNNYNNMNNRNVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFM
NSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKFSYVTPR
AFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAE
EAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERTLEVYL
VRMDPLTKPMQYKVVVPKIGNILDLCTALSALSGIPADKMIVTDIYNHRFHRIFAMDENL
SSIMERDDIYVFEININRTEDTEHVIIPVCLREKFRHSSYTHHTGSSLFGQPFLMAVPRN
NTEDKLYNLLLLRMCRYVKISTETEETEGSLHCCKDQNINGNGPNGIHEEGSPSEMETDE
PDDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEDTCKGQLTGHKKRLFTFQFNNLG
NTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAEDFEKHESVEYKP
PKKPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSY
SRYMRDKLDTLVDFPINDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNKD
DGKWYYFDDSSVSTASEDQIVSKAAYVLFYQRQDTFSGTGFFPLDRETKGASAATGIPLE
SDEDSNDNDNDIENENCMHTN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM65524
NameBDBM65524
Synonyms:(-)-Aricine | Heterophylline (VAN) | Quinovatine
TypeSmall organic molecule
Emp. Form.C22H26N2O4
Mol. Mass.382.4528
SMILESCOC(=O)C1=CO[C@@H](C)[C@@H]2CN3CCc4c([nH]c5cc(OC)ccc45)[C@@H]3C[C@H]12 |t:4|
Structure
n/a