Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUbiquitin carboxyl-terminal hydrolase isozyme L5
LigandBDBM50069762
Substrate/Competitorn/a
Meas. Tech.Fluorometric Ub-AMC Hydrolysis Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50>114000±n/a nM
Commentsextracted
Citation Ott, CABaljinnyam, BZakharov, AVJadhav, ASimeonov, AZhuang, Z Cell Lysate-Based AlphaLISA Deubiquitinase Assay Platform for Identification of Small Molecule Inhibitors. ACS Chem Biol12:2399-2407 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ubiquitin carboxyl-terminal hydrolase isozyme L5
Name:Ubiquitin carboxyl-terminal hydrolase isozyme L5
Synonyms:CGI-70 | UCH-L5 | UCH37 | UCHL5 | Ubiquitin C-terminal hydrolase UCH37 | Ubiquitin carboxyl-terminal hydrolase isozyme L5 | Ubiquitin thioesterase L5
Type:PROTEIN
Mol. Mass.:37597.89
Organism:Homo sapiens (Human)
Description:ChEMBL_109575
Residue:329
Sequence:
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELL
KTLAEHQQLIPLVEKAKEKQNAKKAQETK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50069762
NameBDBM50069762
Synonyms:CHEMBL3182437 | ML323 | US9802904, 87
TypeSmall organic molecule
Emp. Form.C23H24N6
Mol. Mass.384.4769
SMILESCC(C)c1ccccc1-c1ncc(C)c(NCc2ccc(cc2)-n2ccnn2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a