Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetA-kinase anchor protein 7 isoform gamma
LigandBDBM212735
Substrate/Competitorn/a
Meas. Tech.Binding Assay
EC50 5200±0 nM
Citation Tasken, KLygren, BOstensen, EKlaveness, J Tertiary amines for use in the treatment of cardiac disorders US Patent US9556111 Publication Date 1/31/2017
More Info.:Get all data from this article,  Assay Method
 
A-kinase anchor protein 7 isoform gamma
Name:A-kinase anchor protein 7 isoform gamma
Synonyms:A-kinase anchor protein 18 kDa | AKAP 18 | AKAP-7 isoform gamma | PRKA7 isoform gamma | Protein kinase A-anchoring protein 7 isoform gamma
Type:Protein
Mol. Mass.:39515.45
Organism:Homo sapiens (Human)
Description:Q9P0M2
Residue:348
Sequence:
MERPEAGGINSNECENVSRKKKMSEEFEANTMDSLVDMPFATVDIQDDCGITDEPQINLK
RSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNKEIIKGIKILQNAIIQQDERLAKAM
VSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQVGF
VKLAEGDHVNSLLEIAETANRTFQEKGILVGESRSFKPHLTFMKLSKSPWLRKNGVKKID
PDLYEKFISHRFGEEILYRIDLCSMLKKKQSNGYYHCESSIVIGEKNGGEPDDAELVRLS
KRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM212735
NameBDBM212735
Synonyms:US9556111, Table 1.20
TypeSmall organic molecule
Emp. Form.C45H45N7O3
Mol. Mass.731.8839
SMILESCc1ccc(NC(=O)Nc2ccc(CN(Cc3ccc(NC(=O)Nc4ccc(C)cc4)cc3)Cc3ccc(NC(=O)Nc4ccc(C)cc4)cc3)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a