Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase AKT2
LigandBDBM16225
Substrate/CompetitorAKTide-2T
Meas. Tech.PKB In Vitro Enzyme Assay
pH7.2±n/a
Temperature295.15±n/a K
IC50 1600±400 nM
Citation Donald, AMcHardy, TRowlands, MGHunter, LJDavies, TGBerdini, VBoyle, RGAherne, GWGarrett, MDCollins, I Rapid Evolution of 6-Phenylpurine Inhibitors of Protein Kinase B through Structure-Based Design. J Med Chem50:2289-92 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Serine/threonine-protein kinase AKT2
Name:Serine/threonine-protein kinase AKT2
Synonyms:AKT2 | PKB beta | Protein kinase Akt-2 | Protein kinase B (Akt 2) | Protein kinase B beta (AKT2) | Protein kinase B, beta | RAC-PK-beta | RAC-alpha serine/threonine-protein kinase (AKT2) | RAC-beta serine/threonine-protein kinase | RAC-beta serine/threonine-protein kinase (AKT2) | Serine/threonine-protein kinase AKT
Type:Enzyme
Mol. Mass.:55766.64
Organism:Homo sapiens (Human)
Description:n/a
Residue:481
Sequence:
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16225
NameBDBM16225
Synonyms:6-phenylpurine compound 7 | N-methyl-1-[3-(9H-purin-6-yl)phenyl]methanamine | methyl({[3-(9H-purin-6-yl)phenyl]methyl})amine
TypeSmall organic molecule
Emp. Form.C13H13N5
Mol. Mass.239.2758
SMILESCNCc1cccc(c1)-c1ncnc2nc[nH]c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
AKTide-2T
Name:AKTide-2T
Synonyms:AKT/PKB/Rac Protein Kinase Substrate
Type:Peptide
Mol. Mass.:1719.90
Organism:n/a
Description:n/a
Residue:14
Sequence:
ARKRERTYSFGHHA