Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-Dependent Protein Kinase (PKA)
LigandBDBM16224
Substrate/CompetitorPKA-specific peptide substrate
Meas. Tech.PKA In Vitro Enzyme Assay
pH7.2±n/a
Temperature295.15±n/a K
IC50 5200±n/a nM
Citation Donald, AMcHardy, TRowlands, MGHunter, LJDavies, TGBerdini, VBoyle, RGAherne, GWGarrett, MDCollins, I Rapid Evolution of 6-Phenylpurine Inhibitors of Protein Kinase B through Structure-Based Design. J Med Chem50:2289-92 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
cAMP-Dependent Protein Kinase (PKA)
Name:cAMP-dependent protein kinase A
Synonyms:PKA C-alpha | PKC | Protein Kinase C | Protein Kinase C, bovine brain | cAMP-dependent Protein Kinase, bovine heart | cAMP-dependent protein kinase A | cAMP-dependent protein kinase alpha-catalytic subunit | cAMP-dependent protein kinase, alpha-catalytic subunit
Type:Enzyme Complex
Mol. Mass.:40627.77
Organism:Bos taurus (bovine)
Description:The PKA holoenzyme purified from bovine heart, exists as an inactive tetrameric complex, which consists of a regulatory dimer associated with two catalytic subunits. It requires cAMP to activate the enzymatic reaction.
Residue:351
Sequence:
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16224
NameBDBM16224
Synonyms:6-phenylpurine compound 6 | N-methyl-1-[4-(9H-purin-6-yl)phenyl]methanamine | methyl({[4-(9H-purin-6-yl)phenyl]methyl})amine
TypeSmall organic molecule
Emp. Form.C13H13N5
Mol. Mass.239.2758
SMILESCNCc1ccc(cc1)-c1ncnc2nc[nH]c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
PKA-specific peptide substrate
Name:PKA-specific peptide substrate
Synonyms:PKAtide
Type:Peptide
Mol. Mass.:1019.14
Organism:n/a
Description:n/a
Residue:9
Sequence:
GRTGRRNSI