Reaction Details |
 | Report a problem with these data |
Target | cAMP-Dependent Protein Kinase (PKA) |
---|
Ligand | BDBM16225 |
---|
Substrate/Competitor | PKA-specific peptide substrate |
---|
Meas. Tech. | PKA In Vitro Enzyme Assay |
---|
pH | 7.2±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | 5500±n/a nM |
---|
Citation | Donald, A; McHardy, T; Rowlands, MG; Hunter, LJ; Davies, TG; Berdini, V; Boyle, RG; Aherne, GW; Garrett, MD; Collins, I Rapid Evolution of 6-Phenylpurine Inhibitors of Protein Kinase B through Structure-Based Design. J Med Chem50:2289-92 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
cAMP-Dependent Protein Kinase (PKA) |
---|
Name: | cAMP-dependent protein kinase A |
Synonyms: | PKA C-alpha | PKC | Protein Kinase C | Protein Kinase C, bovine brain | cAMP-dependent Protein Kinase, bovine heart | cAMP-dependent protein kinase A | cAMP-dependent protein kinase alpha-catalytic subunit | cAMP-dependent protein kinase, alpha-catalytic subunit |
Type: | Enzyme Complex |
Mol. Mass.: | 40627.77 |
Organism: | Bos taurus (bovine) |
Description: | The PKA holoenzyme purified from bovine heart, exists as an inactive tetrameric complex, which consists of a regulatory dimer associated with two catalytic subunits. It requires cAMP to activate the enzymatic reaction. |
Residue: | 351 |
Sequence: | MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
|
|
|
BDBM16225 |
---|
Name | BDBM16225 |
Synonyms: | 6-phenylpurine compound 7 | N-methyl-1-[3-(9H-purin-6-yl)phenyl]methanamine | methyl({[3-(9H-purin-6-yl)phenyl]methyl})amine |
Type | Small organic molecule |
Emp. Form. | C13H13N5 |
Mol. Mass. | 239.2758 |
SMILES | CNCc1cccc(c1)-c1ncnc2nc[nH]c12 |
Structure |  |
PKA-specific peptide substrate |
---|
Name: | PKA-specific peptide substrate |
Synonyms: | PKAtide |
Type: | Peptide |
Mol. Mass.: | 1019.14 |
Organism: | n/a |
Description: | n/a |
Residue: | 9 |
Sequence: | |