Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase (AR)
LigandBDBM16415
Substrate/CompetitorBDBM16416
Meas. Tech.Enzyme Inhibition Assay
pH7±n/a
Temperature298.15±n/a K
Ki 2000±100 nM
Citation Brownlee, JMCarlson, EMilne, ACPape, EHarrison, DH Structural and thermodynamic studies of simple aldose reductase-inhibitor complexes. Bioorg Chem34:424-44 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Aldose reductase (AR)
Name:Aldose reductase
Synonyms:AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase
Type:Protein
Mol. Mass.:35855.50
Organism:Homo sapiens (Human)
Description:P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0
Residue:316
Sequence:
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16415
NameBDBM16415
Synonyms:(1,3-dioxo-1H-benzo[de]isoquinolin-2(3H)-yl)acetic acid | 2-{2,4-dioxo-3-azatricyclo[7.3.1.0^{5,13}]trideca-1(12),5,7,9(13),10-pentaen-3-yl}acetic acid | Alrestatin | CHEMBL63055 | PiG | Spectrum_001449 | Tocris-0485
TypeSmall organic molecule
Emp. Form.C14H9NO4
Mol. Mass.255.2256
SMILESOC(=O)CN1C(=O)c2cccc3cccc(C1=O)c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM16416
NameBDBM16416
Synonyms:pentane-1,2,3,4,5-pentol | xylitol
TypeSmall organic molecule
Emp. Form.C5H12O5
Mol. Mass.152.1458
SMILESOCC(O)C(O)C(O)CO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: