Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase (AR)
LigandBDBM16417
Substrate/CompetitorBDBM16418
Meas. Tech.Enzyme Inhibition Assay
pH7±n/a
Temperature298.15±n/a K
Ki 1500±300 nM
Citation Brownlee, JMCarlson, EMilne, ACPape, EHarrison, DH Structural and thermodynamic studies of simple aldose reductase-inhibitor complexes. Bioorg Chem34:424-44 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Aldose reductase (AR)
Name:Aldose reductase
Synonyms:AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase
Type:Protein
Mol. Mass.:35855.50
Organism:Homo sapiens (Human)
Description:P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0
Residue:316
Sequence:
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16417
NameBDBM16417
Synonyms:(1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)acetic acid | 2-(1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl)acetic acid | N-Phthaloylglycine | N-Phthalylglycine
TypeSmall organic molecule
Emp. Form.C10H7NO4
Mol. Mass.205.1669
SMILESOC(=O)CN1C(=O)c2ccccc2C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM16418
NameBDBM16418
Synonyms:benzyl alcohol | phenylmethanol
TypeSmall organic molecule
Emp. Form.C7H8O
Mol. Mass.108.1378
SMILESOCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: