Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSUMO-activating enzyme subunit 2 (SAE2)
LigandBDBM329804
Substrate/Competitorn/a
Meas. Tech.HTRF Assay
IC50 55±n/a nM
Citation Afroze, RBharathan, ITCiavarri, JPFleming, PEGaulin, JLGirard, MLangston, SPSoucy, FWong, TYe, Y Pyrazolopyrimidinyl inhibitors of ubiquitin-activating enzyme US Patent US9796725 Publication Date 10/24/2017  Article
More Info.:Get all data from this article,  Assay Method
 
SUMO-activating enzyme subunit 2 (SAE2)
Name:SUMO-activating enzyme subunit 2 (SAE2)
Synonyms:6.3.2.- | Anthracycline-associated resistance ARX | SAE2 | SUMO-activating enzyme subunit 2 | UBA2 | UBLE1B | Ubiquitin-like 1-activating enzyme E1B | Ubiquitin-like modifier-activating enzyme 2
Type:Enzyme
Mol. Mass.:71206.17
Organism:Homo sapiens (Human)
Description:Q9UBT2
Residue:640
Sequence:
MALSRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQ
FLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRA
ARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPS
EPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRIST
KEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEETNASDQQ
NEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAAN
LRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNK
QPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDV
QIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGK
DVEFEVVGDAPEKVGPKQAEDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNN
ADVSEEERSRKRKLDEKENLSAKRSRIEQKEELDDVIALD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM329804
NameBDBM329804
Synonyms:(rac)-[(1R,2R,3S,4R)-2,3-dihydroxy-4-{[2-(pyridin-2-yl)pyrazolo[1,5-a]pyrimidin-7- | US10202389, Compound I-012 | US9663525, Compound I-012 | US9796725, Compound I-012
TypeSmall organic molecule
Emp. Form.C17H20N6O5S
Mol. Mass.420.443
SMILESNS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(nn23)-c2ccccn2)[C@H](O)[C@@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a