Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-3
LigandBDBM352020
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
IC50<10±n/a nM
Citation Vechorkin, OLi, YZhuo, J Pyridineamine compounds useful as Pim kinase inhibitors US Patent US9802918 Publication Date 10/31/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase pim-3
Name:Serine/threonine-protein kinase pim-3
Synonyms:Serine/threonine-protein kinase pim-3 (PIM3)
Type:Protein
Mol. Mass.:35888.19
Organism:Homo sapiens (Human)
Description:Q86V86
Residue:326
Sequence:
MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRI
ADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFL
LVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDL
RSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVC
GDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGV
PESCDLRLCTLDPDDVASTTSSSESL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM352020
NameBDBM352020
Synonyms:(3R,4R,5S)-3-Amino-1-{3-[({6-[2,6-difluoro-4-(3-hydroxytetrahydrofuran-3-yl)phenyl]-5-fluoropyridin-2-yl}methyl)amino]pyridin-4-yl}-5-methylpiperidin-4-ol | US9802918, Example 1
TypeSmall organic molecule
Emp. Form.C27H30F3N5O3
Mol. Mass.529.554
SMILESC[C@H]1CN(C[C@@H](N)[C@@H]1O)c1ccncc1NCc1ccc(F)c(n1)-c1c(F)cc(cc1F)C1(O)CCOC1 |r,wU:5.5,1.0,wD:7.8,(-.67,.74,;-2,-.03,;-2,-1.57,;-3.33,-2.34,;-4.67,-1.57,;-4.67,-.03,;-6,.74,;-3.33,.74,;-3.33,2.28,;-3.33,-3.88,;-4.67,-4.65,;-4.67,-6.19,;-3.33,-6.96,;-2,-6.19,;-2,-4.65,;-.67,-3.88,;.67,-4.65,;2,-3.88,;3.33,-4.65,;4.67,-3.88,;4.67,-2.34,;6,-1.57,;3.33,-1.57,;2,-2.34,;3.33,-.03,;2,.74,;.67,-.03,;2,2.28,;3.33,3.05,;4.67,2.28,;4.67,.74,;6,-.03,;3.33,4.59,;4.67,3.82,;2.09,5.5,;2.56,6.96,;4.1,6.96,;4.58,5.5,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a