Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-2
LigandBDBM352034
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
IC50<100±n/a nM
Citation Vechorkin, OLi, YZhuo, J Pyridineamine compounds useful as Pim kinase inhibitors US Patent US9802918 Publication Date 10/31/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase pim-2
Name:Serine/threonine-protein kinase pim-2
Synonyms:Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase pim-2 (PIM2)
Type:Serine/threonine-protein kinase
Mol. Mass.:34185.93
Organism:Homo sapiens (Human)
Description:Q9P1W9
Residue:311
Sequence:
MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM352034
NameBDBM352034
Synonyms:4-(4-(6-((4-((3S,5R)-3-Amino-5-methylpiperidin-1-yl)pyridin-3-ylamino)methyl)-3-fluoropyridin-2-yl)-3,5-difluorophenyl)tetrahydro-2H-pyran-4-ol | US9802918, Example 6
TypeSmall organic molecule
Emp. Form.C28H32F3N5O2
Mol. Mass.527.5812
SMILESC[C@@H]1C[C@H](N)CN(C1)c1ccncc1NCc1ccc(F)c(n1)-c1c(F)cc(cc1F)C1(O)CCOCC1 |r,wU:1.0,3.3,(-.67,.59,;-2,-.18,;-3.33,.59,;-4.67,-.18,;-6,.59,;-4.67,-1.72,;-3.33,-2.49,;-2,-1.72,;-3.33,-4.03,;-4.67,-4.8,;-4.67,-6.34,;-3.33,-7.11,;-2,-6.34,;-2,-4.8,;-.67,-4.03,;.67,-4.8,;2,-4.03,;3.33,-4.8,;4.67,-4.03,;4.67,-2.49,;6,-1.72,;3.33,-1.72,;2,-2.49,;3.33,-.18,;2,.59,;.67,-.18,;2,2.13,;3.33,2.9,;4.67,2.13,;4.67,.59,;6,-.18,;3.33,4.44,;4.67,3.67,;4.1,5.78,;3.33,7.11,;1.79,7.11,;1.02,5.78,;1.79,4.44,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a