Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-3
LigandBDBM352082
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
IC50<10±n/a nM
Citation Vechorkin, OLi, YZhuo, J Pyridineamine compounds useful as Pim kinase inhibitors US Patent US9802918 Publication Date 10/31/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase pim-3
Name:Serine/threonine-protein kinase pim-3
Synonyms:Serine/threonine-protein kinase pim-3 (PIM3)
Type:Protein
Mol. Mass.:35888.19
Organism:Homo sapiens (Human)
Description:Q86V86
Residue:326
Sequence:
MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRI
ADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFL
LVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDL
RSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVC
GDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGV
PESCDLRLCTLDPDDVASTTSSSESL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM352082
NameBDBM352082
Synonyms:(3R,4R,5S)-3-Amino-1-[3-({[6-(2,6-difluorophenyl)-5-fluoropyridin-2-yl]methyl}amino)pyridin-4-yl]-5-methylpiperidin-4-ol | US9802918, Example 14
TypeSmall organic molecule
Emp. Form.C23H24F3N5O
Mol. Mass.443.4648
SMILESC[C@H]1CN(C[C@@H](N)[C@@H]1O)c1ccncc1NCc1ccc(F)c(n1)-c1c(F)cccc1F |r,wU:5.5,1.0,wD:7.8,(-.67,2.69,;-2,1.92,;-2,.38,;-3.33,-.39,;-4.67,.38,;-4.67,1.92,;-6,2.69,;-3.33,2.69,;-3.33,4.23,;-3.33,-1.93,;-4.67,-2.7,;-4.67,-4.23,;-3.33,-5,;-2,-4.23,;-2,-2.7,;-.67,-1.92,;.67,-2.69,;2,-1.92,;3.33,-2.69,;4.67,-1.92,;4.67,-.38,;6,.39,;3.33,.38,;2,-.38,;3.33,1.92,;2,2.69,;.67,1.93,;2,4.23,;3.33,5,;4.67,4.23,;4.67,2.69,;6,1.93,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a