Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptosis regulator Bcl-2
LigandBDBM354558
Substrate/Competitorn/a
Meas. Tech.Fluorescence Polarisation Assay
IC50 3.00±n/a nM
Citation Davidson, JEMurray, JBChen, IWalmsley, CDodsworth, MMeissner, JWBrough, PFejes, ITatai, JNyerges, MKotschy, ASzlávik, ZGeneste, OLe Tiran, ALe Diguarher, THenlin, JStarck, JGuillouzic, ADe Nanteuil, G Isoindoline or isoquinoline compounds, a process for their preparation and pharmaceutical compositions containing them US Patent US9809574 Publication Date 11/7/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Apoptosis regulator Bcl-2
Name:Apoptosis regulator Bcl-2
Synonyms:Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | Bcl-2 Protein
Type:Homodimer or heterodimer
Mol. Mass.:26269.11
Organism:Homo sapiens (Human)
Description:P10415
Residue:239
Sequence:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM354558
NameBDBM354558
Synonyms:4-Cyano-2-methoxyphenyl 6-{1-[(4-hydroxyphenyl)(methyl)carbamoyl]-5,6,7,8-tetrahydroindolizin-3-yl}-7-[(3S)-3-(morpholin-4-ylmethyl)-1,2,3,4-tetrahydroisoquinoline-2-carbonyl]-1,2,3,4-tetrahydroisoquinoline-2-carboxylate | US9809574, Example 148
TypeSmall organic molecule
Emp. Form.C49H50N6O7
Mol. Mass.834.9573
SMILESCOc1cc(ccc1OC(=O)N1CCc2cc(-c3cc(C(=O)N(C)c4ccc(O)cc4)c4CCCCn34)c(cc2C1)C(=O)N1Cc2ccccc2C[C@H]1CN1CCOCC1)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a