Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycogen Synthase Kinase-3, beta
LigandBDBM17149
Substrate/CompetitorGSK-3 Peptide Substrate
Meas. Tech.GSK-3 beta Inhibition Assay
pH7.5±n/a
Temperature295.15±n/a K
IC50 2±n/a nM
Citation Richardson, CMNunns, CLWilliamson, DSParratt, MJDokurno, PHowes, RBorgognoni, JDrysdale, MJFinch, HHubbard, REJackson, PSKierstan, PLentzen, GMoore, JDMurray, JBSimmonite, HSurgenor, AETorrance, CJ Discovery of a potent CDK2 inhibitor with a novel binding mode, using virtual screening and initial, structure-guided lead scoping. Bioorg Med Chem Lett17:3880-5 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Glycogen Synthase Kinase-3, beta
Name:Glycogen Synthase Kinase-3, beta
Synonyms:GSK-3, beta
Type:Enzyme
Mol. Mass.:46754.43
Organism:Rattus norvegicus (rat)
Description:The rat GSK-3 beta cDNA was inserted into the baculovirus vector. The protein was purified from virus-infected sf9 insect cells
Residue:420
Sequence:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDM
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17149
NameBDBM17149
Synonyms:2-imino-thiazolidin-4-one analog, 11 | 4-(5-{[(5Z)-2-imino-4-oxo-1,3-thiazolidin-5-ylidene]methyl}furan-2-yl)-2-(trifluoromethyl)benzene-1-sulfonamide
TypeSmall organic molecule
Emp. Form.C15H10F3N3O4S2
Mol. Mass.417.383
SMILESNS(=O)(=O)c1ccc(cc1C(F)(F)F)-c1ccc(\C=C2/SC(=N)NC2=O)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
GSK-3 Peptide Substrate
Name:GSK-3 Peptide Substrate
Synonyms:GS-1 Peptide | Phospho-GS2 Substrate Peptide
Type:Peptide
Mol. Mass.:3045.17
Organism:n/a
Description:n/a
Residue:27
Sequence:
YRRAAVPPSPSLSRHSSPHQS(PO4)EDEEE