Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProthrombin
LigandBDBM17257
Substrate/CompetitorBDBM12680
Meas. Tech.Enzyme Inhibition Assay
Ki 120±n/a nM
Citation Kochanny, MJAdler, MEwing, JGriedel, BDHo, EKaranjawala, RLee, WLentz, DLiang, AMMorrissey, MMPhillips, GBPost, JSacchi, KLSakata, STSubramanyam, BVergona, RWalters, JWhite, KAWhitlow, MYe, BZhao, ZShaw, KJ Substituted thiophene-anthranilamides as potent inhibitors of human factor Xa. Bioorg Med Chem15:2127-46 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Prothrombin
Name:Thrombin and coagulation factor X
Synonyms:Activation peptide fragment 1 | Activation peptide fragment 2 | Coagulation factor II | F2 | Prothrombin precursor | Thrombin heavy chain | Thrombin light chain
Type:Protein
Mol. Mass.:70029.57
Organism:Homo sapiens (Human)
Description:P00734
Residue:622
Sequence:
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP
VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST
RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17257
NameBDBM17257
Synonyms:3-chloro-N-{4-chloro-2-[(4-chlorophenyl)carbamoyl]phenyl}-4-({[2-(diethylamino)ethyl](methyl)amino}methyl)thiophene-2-carboxamide | thiophene-containing non-amidine inhibitor, 59
TypeSmall organic molecule
Emp. Form.C26H29Cl3N4O2S
Mol. Mass.567.958
SMILESCCN(CC)CCN(C)Cc1csc(C(=O)Nc2ccc(Cl)cc2C(=O)Nc2ccc(Cl)cc2)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM12680
NameBDBM12680
Synonyms:(2S)-N-[(2S)-5-carbamimidamido-2-[(4-nitrophenyl)amino]pentanoyl]-3-phenyl-2-[(2R)-pyrrolidin-2-ylformamido]propanamide | Chromogenic Substrate S-2302 | H-D-Pro-Phe-Arg-p-nitroanilide | prolyl-phenylalanyl-arginine-p-nitroanilide
TypeSmall organic molecule
Emp. Form.C26H34N8O5
Mol. Mass.538.5988
SMILESN\C([NH-])=[NH+]/CCCC(NC(=O)C(Cc1ccccc1)NC(=O)C1CCCN1)C(=O)Nc1ccc(cc1)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: