Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargettRNA synthetase (GlyRS)
LigandBDBM18137
Substrate/CompetitorBDBM18133
Meas. Tech.In Vitro Enzyme Activity Assay
pH7.5±n/a
Temperature298.15±n/a K
Ki 80000±n/a nM
IC50 800000±n/a nM
Citation Dignam, JDNada, SChaires, JB Thermodynamic characterization of the binding of nucleotides to glycyl-tRNA synthetase. Biochemistry42:5333-40 (2003) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
tRNA synthetase (GlyRS)
Name:tRNA synthetase (GlyRS)
Synonyms:Glycine--tRNA ligase | Glycyl-tRNA synthetase
Type:Enzyme
Mol. Mass.:76917.70
Organism:Bombyx mori
Description:B. mori glycyltRNA synthetase was expressed in E. coli.
Residue:680
Sequence:
MADPKIEEILAPLRANVKEQGDLVRKLKEEKAPEIDIKKAVAELKTRKKILEDKELSLAP
AEDLFDRAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIHLWKKFFILQEQ
MLEVECSILTPEPVLKASGHVERFADLMTKDIKTGECFRLDHLIKGHLEKIKSDKNTKIE
LKAEIEDILIKLDGMNADEMSALMKRFEMKSPISGNDLTPPIEFNLMFNTQIGPSGLVKG
FLRPETAQGIFVNFKRLLEFNQGRLPFAAAQIGNSFRNEISPRSGLLRVREFTMCEIEHF
CDVKEHPKFESVKNTQSLLYSADNQEQGKPADLTTIGDAVCKGIVNNETLGYFMARIHMY
MLAVGIDPKRLRFRQHMGNEMAHYACDCWDAECLSSYGWIECVGCADRSAYDLTQHTKAT
GIRLAAEKKLPAPKQIEVVEAIANNGRIGKAFKKDSQAINDTLATLDNAALEEMQKELDS
NGEYTLITARGEFKLTPSLVNVKKTQKTIHVEEIIPSVIEPSFGVGRILYCILEHNFRMR
EGDEQRTYFSLPPTVAPMKCVVLPLSGNAEFQPFVRDLSQELITVDVSHKVDDSSGSIGR
RYARTDELGVPYAVTVDFDTIKEPHTVTLRERDSMRQVRLPMADVPTVVRDLSNSKILWS
DVEQKYPKFEQQETVKGTSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18137
NameBDBM18137
Synonyms:AMP | CHEMBL752 | [(2R,3S,4R,5R)-5-adenin-9-yl-3,4-dihydroxy-tetrahydrofuran-2-yl]methyl dihydrogen phosphate;hydrate | adenosine 5 -monophosphate | {[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}phosphonic acid
TypeNucleoside or nucleotide
Emp. Form.C10H14N5O7P
Mol. Mass.347.2212
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM18133
NameBDBM18133
Synonyms:2-aminoacetic acid | CHEMBL773 | Glycine | [14C]Glycine
TypeAmino Acid
Emp. Form.C2H5NO2
Mol. Mass.75.0666
SMILESNCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: