Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 1
LigandBDBM50032927
Substrate/Competitorn/a
Meas. Tech.Alpha Screen competitive assay
pH7.4±n/a
Temperature298.15±n/a K
IC50 3517±183 nM
Commentsextracted
Citation Meier, JCTallant, CFedorov, OWitwicka, HHwang, SYvan Stiphout, RGLambert, JPRogers, CYapp, CGerstenberger, BSFedele, VSavitsky, PHeidenreich, DDaniels, DLOwen, DRFish, PVIgoe, NMBayle, EDHaendler, BOppermann, UCTBuffa, FBrennan, PEMüller, SGingras, ACOdgren, PRBirnbaum, MJKnapp, S Selective Targeting of Bromodomains of the Bromodomain-PHD Fingers Family Impairs Osteoclast Differentiation. ACS Chem Biol12:2619-2630 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 1
Name:Bromodomain-containing protein 1
Synonyms:BR140-like protein | BRD1 | BRL | BRPF2 | Bromodomain and PHD finger-containing protein 2 | Bromodomain-containing protein 1
Type:PROTEIN
Mol. Mass.:119557.65
Organism:Homo sapiens (Human)
Description:ChEMBL_105349
Residue:1058
Sequence:
MRRKGRCHRGSAARHPSSPCSVKHSPTRETLTYAQAQRMVEIEIEGRLHRISIFDPLEII
LEDDLTAQEMSECNSNKENSERPPVCLRTKRHKNNRVKKKNEALPSAHGTPASASALPEP
KVRIVEYSPPSAPRRPPVYYKFIEKSAEELDNEVEYDMDEEDYAWLEIVNEKRKGDCVPA
VSQSMFEFLMDRFEKESHCENQKQGEQQSLIDEDAVCCICMDGECQNSNVILFCDMCNLA
VHQECYGVPYIPEGQWLCRHCLQSRARPADCVLCPNKGGAFKKTDDDRWGHVVCALWIPE
VGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKGVGACIQCHKANCYTAFHVTCAQKAGL
YMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGCTRRPLNIYGDVEMKNGVCRKESSVKTV
RSTSKVRKKAKKAKKALAEPCAVLPTVCAPYIPPQRLNRIANQVAIQRKKQFVERAHSYW
LLKRLSRNGAPLLRRLQSSLQSQRSSQQRENDEEMKAAKEKLKYWQRLRHDLERARLLIE
LLRKREKLKREQVKVEQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYL
DHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGG
VVLRQARREVDSIGLEEASGMHLPERPAAAPRRPFSWEDVDRLLDPANRAHLGLEEQLRE
LLDMLDLTCAMKSSGSRSKRAKLLKKEIALLRNKLSQQHSQPLPTGPGLEGFEEDGAALG
PEAGEEVLPRLETLLQPRKRSRSTCGDSEVEEESPGKRLDAGLTNGFGGARSEQEPGGGL
GRKATPRRRCASESSISSSNSPLCDSSFNAPKCGRGKPALVRRHTLEDRSELISCIENGN
YAKAARIAAEVGQSSMWISTDAAASVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHN
GVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKM
MEGRNSSIRKAVRIAFDRAMNHLSRVHGEPTSDLSDID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032927
NameBDBM50032927
Synonyms:CHEMBL3356143 | N-[2,3-Dihydro-1,3-dimethyl-2-oxo-6-(1-pyrrolidinyl)-1H-benzimidazol-5-yl]-2-methoxybenzamide | PFI 4 | PFI-4 | PFI4
TypeSmall organic molecule
Emp. Form.C21H24N4O3
Mol. Mass.380.4403
SMILESCOc1ccccc1C(=O)Nc1cc2n(C)c(=O)n(C)c2cc1N1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a