Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeregrin
LigandBDBM50032927
Substrate/Competitorn/a
Meas. Tech.Alpha Screen competitive assay
pH7.4±n/a
Temperature298.15±n/a K
IC50 172±10.0 nM
Commentsextracted
Citation Meier, JCTallant, CFedorov, OWitwicka, HHwang, SYvan Stiphout, RGLambert, JPRogers, CYapp, CGerstenberger, BSFedele, VSavitsky, PHeidenreich, DDaniels, DLOwen, DRFish, PVIgoe, NMBayle, EDHaendler, BOppermann, UCTBuffa, FBrennan, PEMüller, SGingras, ACOdgren, PRBirnbaum, MJKnapp, S Selective Targeting of Bromodomains of the Bromodomain-PHD Fingers Family Impairs Osteoclast Differentiation. ACS Chem Biol12:2619-2630 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peregrin
Name:Peregrin
Synonyms:BR140 | BRPF1 | Bromodomain and PHD finger-containing protein 1 | Peregrin | Protein Br140
Type:PROTEIN
Mol. Mass.:137524.47
Organism:Homo sapiens (Human)
Description:ChEMBL_108054
Residue:1214
Sequence:
MGVDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPPPPQQTPLRK
HKKKGRQSRPANKQSPSPSEVSQSPGREVMSYAQAQRMVEVDLHGRVHRISIFDNLDVVS
EDEEAPEEAPENGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVV
YRELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNERRKTEGVSPI
PQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAV
HQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEV
CFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLY
MKMEPVRETGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSS
EKVKKAKAKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRL
HSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLER
ARLLVELIRKREKLKRETIKVQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLS
EVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVR
LREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTEDAAEEERLVLLENQKHL
PVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPS
SRGSLTPHPAACDKDGQTDSAAEESSSQETSKGLGPNMSSTPAHEVGRRTSVLFSKKNPK
TAGPPKRPGRPPKNRESQMTPSHGGSPVGPPQLPIMSSLRQRKRGRSPRPSSSSDSDSDK
STEDPPMDLPANGFSGGNQPVKKSFLVYRNDCSLPRSSSDSESSSSSSSSAASDRTSTTP
SKQGRGKPSFSRGTFPEDSSEDTSGTENEAYSVGTGRGVGHSMVRKSLGRGAGWLSEDED
SPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEARE
HLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRS
KVQGEQSSETSDSD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032927
NameBDBM50032927
Synonyms:CHEMBL3356143 | N-[2,3-Dihydro-1,3-dimethyl-2-oxo-6-(1-pyrrolidinyl)-1H-benzimidazol-5-yl]-2-methoxybenzamide | PFI 4 | PFI-4 | PFI4
TypeSmall organic molecule
Emp. Form.C21H24N4O3
Mol. Mass.380.4403
SMILESCOc1ccccc1C(=O)Nc1cc2n(C)c(=O)n(C)c2cc1N1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a