Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeregrin
LigandBDBM50148549
Substrate/Competitorn/a
Meas. Tech.Alpha Screen competitive assay
pH7.4±n/a
Temperature298.15±n/a K
IC50 270±180 nM
Commentsextracted
Citation Meier, JCTallant, CFedorov, OWitwicka, HHwang, SYvan Stiphout, RGLambert, JPRogers, CYapp, CGerstenberger, BSFedele, VSavitsky, PHeidenreich, DDaniels, DLOwen, DRFish, PVIgoe, NMBayle, EDHaendler, BOppermann, UCTBuffa, FBrennan, PEMüller, SGingras, ACOdgren, PRBirnbaum, MJKnapp, S Selective Targeting of Bromodomains of the Bromodomain-PHD Fingers Family Impairs Osteoclast Differentiation. ACS Chem Biol12:2619-2630 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peregrin
Name:Peregrin
Synonyms:BR140 | BRPF1 | Bromodomain and PHD finger-containing protein 1 | Peregrin | Protein Br140
Type:PROTEIN
Mol. Mass.:137524.47
Organism:Homo sapiens (Human)
Description:ChEMBL_108054
Residue:1214
Sequence:
MGVDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPPPPQQTPLRK
HKKKGRQSRPANKQSPSPSEVSQSPGREVMSYAQAQRMVEVDLHGRVHRISIFDNLDVVS
EDEEAPEEAPENGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVV
YRELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNERRKTEGVSPI
PQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAV
HQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEV
CFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLY
MKMEPVRETGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSS
EKVKKAKAKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRL
HSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLER
ARLLVELIRKREKLKRETIKVQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLS
EVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVR
LREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTEDAAEEERLVLLENQKHL
PVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPS
SRGSLTPHPAACDKDGQTDSAAEESSSQETSKGLGPNMSSTPAHEVGRRTSVLFSKKNPK
TAGPPKRPGRPPKNRESQMTPSHGGSPVGPPQLPIMSSLRQRKRGRSPRPSSSSDSDSDK
STEDPPMDLPANGFSGGNQPVKKSFLVYRNDCSLPRSSSDSESSSSSSSSAASDRTSTTP
SKQGRGKPSFSRGTFPEDSSEDTSGTENEAYSVGTGRGVGHSMVRKSLGRGAGWLSEDED
SPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEARE
HLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRS
KVQGEQSSETSDSD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50148549
NameBDBM50148549
Synonyms:4-Bromo-N-(2,3-dihydro-6-methoxy-1,3-dimethyl-2-oxo-1H-benzimidazol-5-yl)-2-methyl-benzenesulfonamide | 4-Bromo-N-(2,3-dihydro-6-methoxy-1,3-dimethyl-2-oxo-1H-benzimidazol-5-yl)-2-methylbenzenesulfonamide | CHEMBL3770173 | OF 1 | OF-1
TypeSmall organic molecule
Emp. Form.C17H18BrN3O4S
Mol. Mass.440.312
SMILESCOc1cc2n(C)c(=O)n(C)c2cc1NS(=O)(=O)c1ccc(Br)cc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a