Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBIR2
LigandBDBM239445
Substrate/Competitorn/a
Meas. Tech.TR-FRET Assay for BIR2 and BIR3
pH7.5±n/a
Temperature298.15±n/a K
IC50 188±n/a nM
Commentsextracted
Citation Chen, SDonnell, AFKester, RFLe, KLou, YMichoud, CRemiszewski, SRupert, KCWeisel, M Tetrahydro-benzodiazepinones US Patent US10053431 Publication Date 8/21/2018
More Info.:Get all data from this article,  Assay Method
 
BIR2
Name:BIR2
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:14676.71
Organism:n/a
Description:n/a
Residue:125
Sequence:
MRHHHHHHRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPD
YAHLTPRELASAGLYYTGIGDQVQCFACGGKLKNWEPGDRAWSEHRRHFPNCFFVLGRNL
NIRSE
 
BDBM239445
NameBDBM239445
Synonyms:US10053431, 98b
TypeSmall organic molecule
Emp. Form.C26H31N5O4S
Mol. Mass.509.62
SMILESCN[C@@H](C)C(=O)N[C@H]1CN(c2ccccc2N(Cc2c(C)ccc3ccccc23)C1=O)S(=O)(=O)NC |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a