Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBIR2
LigandBDBM241607
Substrate/Competitorn/a
Meas. Tech.TR-FRET Assay for BIR2 and BIR3
pH7.5±n/a
Temperature298.15±n/a K
IC50 9.14±n/a nM
Commentsextracted
Citation Chen, SDonnell, AFKester, RFLe, KLou, YMichoud, CRemiszewski, SRupert, KCWeisel, M Tetrahydro-benzodiazepinones US Patent US10053431 Publication Date 8/21/2018
More Info.:Get all data from this article,  Assay Method
 
BIR2
Name:BIR2
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:14676.71
Organism:n/a
Description:n/a
Residue:125
Sequence:
MRHHHHHHRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPD
YAHLTPRELASAGLYYTGIGDQVQCFACGGKLKNWEPGDRAWSEHRRHFPNCFFVLGRNL
NIRSE
 
BDBM241607
NameBDBM241607
Synonyms:(2S)-N-((3S)-1-((6-bromo-2- methoxynaphthalen-1-yl)methyl)-5-(4-(1- hydroxyethyl)benzoyl)-2-oxo-2,3,4,5- tetrahydro-1H-benzo[b][1,4]diazepin-3- yl)-2-(methylamino)propanamide | BDBM242602 | US10053431, 103 | US10053431, 104
TypeSmall organic molecule
Emp. Form.C34H35BrN4O5
Mol. Mass.659.569
SMILESCN[C@@H](C)C(=O)N[C@H]1CN(C(=O)c2ccc(cc2)C(C)O)c2ccccc2N(Cc2c(OC)ccc3cc(Br)ccc23)C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a