Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBIR2
LigandBDBM242606
Substrate/Competitorn/a
Meas. Tech.TR-FRET Assay for BIR2 and BIR3
pH7.5±n/a
Temperature298.15±n/a K
IC50 6.00±n/a nM
Commentsextracted
Citation Chen, SDonnell, AFKester, RFLe, KLou, YMichoud, CRemiszewski, SRupert, KCWeisel, M Tetrahydro-benzodiazepinones US Patent US10053431 Publication Date 8/21/2018
More Info.:Get all data from this article,  Assay Method
 
BIR2
Name:BIR2
Synonyms:6x Histidine-tagged BIR2 domain | amino acids 124-240 of XIAP
Type:Enzyme Catalytic Domain
Mol. Mass.:14676.71
Organism:Homo sapiens (Human)
Description:n/a
Residue:125
Sequence:
MRHHHHHHRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPD
YAHLTPRELASAGLYYTGIGDQVQCFACGGKLKNWEPGDRAWSEHRRHFPNCFFVLGRNL
NIRSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM242606
NameBDBM242606
Synonyms:(S)—N—((S)-5-(4-aminobenzoyl)-1-((6-bromo-2-methoxynaphthalen-1-yl)methyl)-2-oxo-2,3,4,5-tetrahydro-1H-benzo[b][1,4]diazepin-3-yl)-2-(methylamino)propanamide dihydrochloride | US10053431, 35
TypeSmall organic molecule
Emp. Form.C32H32BrN5O4
Mol. Mass.630.532
SMILESCN[C@@H](C)C(=O)N[C@H]1CN(C(=O)c2ccc(N)cc2)c2ccccc2N(Cc2c(OC)ccc3cc(Br)ccc23)C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a