Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBIR3
LigandBDBM50441816
Substrate/Competitorn/a
Meas. Tech.TR-FRET Assay for BIR2 and BIR3
pH7.5±n/a
Temperature298.15±n/a K
IC50 24520±n/a nM
Commentsextracted
Citation Chen, SDonnell, AFKester, RFLe, KLou, YMichoud, CRemiszewski, SRupert, KCWeisel, M Tetrahydro-benzodiazepinones US Patent US10053431 Publication Date 8/21/2018  Article
More Info.:Get all data from this article,  Assay Method
 
BIR3
Name:BIR3
Synonyms:BIR3 domain | XIAP Bir3 | amino acids 241-356 of XIAP
Type:Enzyme Catalytic Domain
Mol. Mass.:14548.06
Organism:Homo sapiens (Human)
Description:n/a
Residue:125
Sequence:
MRHHHHHHRSDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYA
LGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEEC
LVRTT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50441816
NameBDBM50441816
Synonyms:CHEMBL2436208 | US10053431, 41
TypeSmall organic molecule
Emp. Form.C32H33N5O4
Mol. Mass.551.6355
SMILESCN[C@@H](C)C(=O)N[C@H]1CN(C(=O)c2ccc(N)cc2)c2ccccc2N(Cc2c(OC)ccc3ccccc23)C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a