Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAP-4-A phosphorylase
LigandBDBM65563
Substrate/Competitorn/a
Meas. Tech.FRET assay
pH8±n/a
IC50 470±60 nM
Commentsextracted
Citation Götz, KHHacker, SMMayer, DDürig, JNStenger, SMarx, A Inhibitors of the Diadenosine Tetraphosphate Phosphorylase Rv2613c of Mycobacterium tuberculosis. ACS Chem Biol12:2682-2689 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
AP-4-A phosphorylase
Name:AP-4-A phosphorylase
Synonyms:AP,A phosphorylase | ATP adenylyltransferase | Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase
Type:Protein
Mol. Mass.:21869.52
Organism:n/a
Description:P9WMK9
Residue:195
Sequence:
MSDEDRTDRATEDHTIFDRGVGQRDQLQRLWTPYRMNYLAEAPVKRDPNSSASPAQPFTE
IPQLSDEEGLVVARGKLVYAVLNLYPYNPGHLMVVPYRRVSELEDLTDLESAELMAFTQK
AIRVIKNVSRPHGFNVGLNLGTSAGGSLAEHLHVHVVPRWGGDANFITIIGGSKVIPQLL
RDTRRLLATEWARQP
 
BDBM65563
NameBDBM65563
Synonyms:Synthesized Sulfanylacrylonitril Derivatives 10
TypeSmall organic molecule
Emp. Form.C19H17F3N2O2S2
Mol. Mass.426.476
SMILESCCCS\C(Nc1cccc(c1)C(F)(F)F)=C(\C#N)S(=O)(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a