Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM247009
Substrate/Competitorn/a
Meas. Tech.Opioid Receptor Affinity
Ki 47.0±n/a nM
Citation Godek, DMHoward, HR Kappa opioid receptor compounds US Patent US9700563 Publication Date 7/11/2017
More Info.:Get all data from this article,  Assay Method
 
Kappa-type opioid receptor
Name:Opioid receptors; mu/kappa/delta
Synonyms:K-OR-1 | KOR-1 | Kappa-opioid receptor (KOR) | Kappa-type opioid receptor (KOPR) | Kappa-type opioid receptor (KOR) | Kappa-type opioid receptor (Kappa) | OPIATE Kappa | OPRK | OPRK1 | kappa opioid receptor (KOR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42648.76
Organism:Homo sapiens (human)
Description:Competition binding assays were carried out using membrane preparations from HEK-293 cells stably expressing KOP receptors.
Residue:380
Sequence:
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM247009
NameBDBM247009
Synonyms:US9700563, 7
TypeSmall organic molecule
Emp. Form.C22H24FN3O
Mol. Mass.365.4439
SMILESCN(C)CCCC1(OCc2cc(ccc12)-c1ncc[nH]1)c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a