Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHemagglutinin
LigandBDBM31169
Substrate/Competitorn/a
Meas. Tech.Endonuclease Assay
pH7.5±n/a
IC50>100000±n/a nM
Commentsextracted
Citation Lavoie, EJBauman, JDSagong, HYArnold, EParhi, ADas, KVijayan, SKPatel, D Therapeutic hydroxyquinolones US Patent US9701638 Publication Date 7/11/2017
More Info.:Get all data from this article,  Assay Method
 
Hemagglutinin
Name:Hemagglutinin
Synonyms:HA | Hemagglutinin HA1 chain
Type:Enzyme Catalytic Domain
Mol. Mass.:63281.44
Organism:Influenza A virus (strain swl A/California/04/2009 H1N1)
Description:C3W5S1
Residue:566
Sequence:
MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK
LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEELRE
QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK
SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADTYVFVGSSRYSKKFKPEIAIRPKVRDQ
EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK
GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNIPSIQSRGLFGAIAGFIEGGWTG
MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR
IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG
CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS
LVLVVSLGAISFWMCSNGSLQCRICI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31169
NameBDBM31169
Synonyms:3-hydroxyquinolin-2(1H)-one, 23 | US9701638, 14
TypeSmall organic molecule
Emp. Form.C10H9NO2
Mol. Mass.175.184
SMILESCc1c(O)c(=O)[nH]c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a