Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetemsa
LigandBDBM367261
Substrate/Competitorn/a
Meas. Tech.Electrophoretic Mobility Shift Assay (EMSA)
IC50<500±n/a nM
Citation Ouk, SLiou, H Small molecule NF-κB inhibitors US Patent US10226464 Publication Date 3/12/2019
More Info.:Get all data from this article,  Assay Method
 
emsa
Name:Nuclear factor NF-kappa-B (NF-kB)
Synonyms:Nuclear factor NF-kappa-B complex | Nuclear factor NF-kappa-B p105 subunit
Type:Protein
Mol. Mass.:105329.57
Organism:Homo sapiens (Human)
Description:P19838
Residue:968
Sequence:
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM367261
NameBDBM367261
Synonyms:US10226464, Compound 29
TypeSmall organic molecule
Emp. Form.C15H13FN2O4
Mol. Mass.304.2731
SMILESCCCCOc1cc2oc3nc(=O)[nH]c(=O)c3cc2cc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a