Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetnf-kb gfp
LigandBDBM367300
Substrate/Competitorn/a
Meas. Tech.NF-keppaB GFP Assay
IC50<5000±n/a nM
Citation Ouk, SLiou, H Small molecule NF-κB inhibitors US Patent US10226464 Publication Date 3/12/2019
More Info.:Get all data from this article,  Assay Method
 
nf-kb gfp
Name:Nuclear factor NF-kappa-B (NF-kB)
Synonyms:Nuclear factor NF-kappa-B complex | Nuclear factor NF-kappa-B p105 subunit
Type:Protein
Mol. Mass.:105329.57
Organism:Homo sapiens (Human)
Description:P19838
Residue:968
Sequence:
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM367300
NameBDBM367300
Synonyms:US10226464, Compound 67
TypeSmall organic molecule
Emp. Form.C16H16N2O5
Mol. Mass.316.3086
SMILESCOCCCCOc1ccc2cc3c(nc(=O)[nH]c3=O)oc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a