Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-1 receptor-associated kinase 4
LigandBDBM203289
Substrate/Competitorn/a
Meas. Tech.IRAK4 Inhibition Assay
IC50 2.70±n/a nM
Citation Paidi, VRKumar, SRBanerjee, ASistla, RKNair, SKPitts, WJHynes, J Thiazolyl- or thiadiazolyl-substituted pyridyl compounds useful as kinase inhibitors US Patent US10227340 Publication Date 3/12/2019
More Info.:Get all data from this article,  Assay Method
 
Interleukin-1 receptor-associated kinase 4
Name:Interleukin-1 receptor-associated kinase 4
Synonyms:IRAK-4 | Interleukin-1 receptor-associated kinase 4 (IRAK-4) | Interleukin-1 receptor-associated kinase 4 (IRAK4) | Renal carcinoma antigen NY-REN-64
Type:Protein
Mol. Mass.:51519.08
Organism:Homo sapiens (Human)
Description:Q9NWZ3
Residue:460
Sequence:
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV
QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM203289
NameBDBM203289
Synonyms:US10227340, Example 25 | US9242975, 25
TypeSmall organic molecule
Emp. Form.C28H35N7OS2
Mol. Mass.549.754
SMILESCC(C)Nc1cc(Nc2ccc3ncsc3c2)ncc1-c1nc(C(=O)NCCCN2CCCCC2)c(C)s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a