Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-1 receptor-associated kinase 4
LigandBDBM203302
Substrate/Competitorn/a
Meas. Tech.IRAK4 Inhibition Assay
IC50 676±n/a nM
Citation Paidi, VRKumar, SRBanerjee, ASistla, RKNair, SKPitts, WJHynes, J Thiazolyl- or thiadiazolyl-substituted pyridyl compounds useful as kinase inhibitors US Patent US10227340 Publication Date 3/12/2019
More Info.:Get all data from this article,  Assay Method
 
Interleukin-1 receptor-associated kinase 4
Name:Interleukin-1 receptor-associated kinase 4
Synonyms:IRAK-4 | Interleukin-1 receptor-associated kinase 4 (IRAK-4) | Interleukin-1 receptor-associated kinase 4 (IRAK4) | Renal carcinoma antigen NY-REN-64
Type:Protein
Mol. Mass.:51519.08
Organism:Homo sapiens (Human)
Description:Q9NWZ3
Residue:460
Sequence:
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV
QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM203302
NameBDBM203302
Synonyms:US10227340, Example 143 | US9242975, 143
TypeSmall organic molecule
Emp. Form.C27H28FN7O3S2
Mol. Mass.581.685
SMILESCC(C)Nc1cc(Nc2ccc3ncsc3c2)ncc1-c1nnc(o1)-c1ccc(F)c(c1)S(=O)(=O)NC(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a