Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBcl-2-like protein 1
LigandBDBM21424
Substrate/CompetitorFluorescein-labeled BAD peptide
Meas. Tech.Fluorescence Polarization (FP) Assay and FL5.12 Cellular Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki<0.5±n/a nM
IC50 700±n/a nM
EC50 350±50 nM
Citation Bruncko, MOost, TKBelli, BADing, HJoseph, MKKunzer, AMartineau, DMcClellan, WJMitten, MNg, SCNimmer, PMOltersdorf, TPark, CMPetros, AMShoemaker, ARSong, XWang, XWendt, MDZhang, HFesik, SWRosenberg, SHElmore, SW Studies leading to potent, dual inhibitors of Bcl-2 and Bcl-xL. J Med Chem50:641-62 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Bcl-2-like protein 1
Name:Bcl-2-like protein 1
Synonyms:Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | BCL2-like 1 isoform 1 | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD)
Type:Mitochondrion membrane; Single-pass membrane protein
Mol. Mass.:26039.60
Organism:Homo sapiens
Description:n/a
Residue:233
Sequence:
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21424
NameBDBM21424
Synonyms:4-Piperidinebenzylidene derivative, 10c | 4-{4-[(2-chlorophenyl)methylidene]piperidin-1-yl}-N-[(4-{[(2R)-4-(dimethylamino)-1-(phenylsulfanyl)butan-2-yl]amino}-3-nitrobenzene)sulfonyl]benzamide
TypeSmall organic molecule
Emp. Form.C37H40ClN5O5S2
Mol. Mass.734.327
SMILES[#6]-[#7](-[#6])-[#6]-[#6]-[#6@H](-[#6]-[#16]-c1ccccc1)-[#7]-c1ccc(cc1-[#7+](-[#8-])=O)S(=O)(=O)[#7]-[#6](=O)-c1ccc(cc1)-[#7]-1-[#6]-[#6]\[#6](-[#6]-[#6]-1)=[#6]/c1ccccc1Cl |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Fluorescein-labeled BAD peptide
Name:Fluorescein-labeled BAD peptide
Synonyms:n/a
Type:fluorescein-labeled probe
Mol. Mass.:3078.53
Organism:n/a
Description:n/a
Residue:25
Sequence:
NLWAAQRYGRELRRMSDK(FITC)FVD