Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptosis regulator Bcl-2
LigandBDBM21405
Substrate/CompetitorFluorescein-labeled BAX peptide
Meas. Tech.Fluorescence Polarization Assay and FL5.12 Cellular Assay
Ki 3.4±n/a nM
EC50 600±n/a nM
Citation Bruncko, MOost, TKBelli, BADing, HJoseph, MKKunzer, AMartineau, DMcClellan, WJMitten, MNg, SCNimmer, PMOltersdorf, TPark, CMPetros, AMShoemaker, ARSong, XWang, XWendt, MDZhang, HFesik, SWRosenberg, SHElmore, SW Studies leading to potent, dual inhibitors of Bcl-2 and Bcl-xL. J Med Chem50:641-62 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Apoptosis regulator Bcl-2
Name:Apoptosis regulator Bcl-2
Synonyms:Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | Bcl-2 Protein
Type:Homodimer or heterodimer
Mol. Mass.:26269.11
Organism:Homo sapiens (Human)
Description:P10415
Residue:239
Sequence:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21405
NameBDBM21405
Synonyms:4-Piperidinebenzylidene derivative, 10a | N-[(4-{[(2R)-4-(dimethylamino)-1-(phenylsulfanyl)butan-2-yl]amino}-3-nitrobenzene)sulfonyl]-4-{4-[(4-fluorophenyl)methylidene]piperidin-1-yl}benzamide
TypeSmall organic molecule
Emp. Form.C37H40FN5O5S2
Mol. Mass.717.872
SMILES[#6]-[#7](-[#6])-[#6]-[#6]-[#6@H](-[#6]-[#16]-c1ccccc1)-[#7]-c1ccc(cc1-[#7+](-[#8-])=O)S(=O)(=O)[#7]-[#6](=O)-c1ccc(cc1)-[#7]-1-[#6]-[#6]\[#6](-[#6]-[#6]-1)=[#6]/c1ccc(F)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Fluorescein-labeled BAX peptide
Name:Fluorescein-labeled BAX peptide
Synonyms:n/a
Type:fluorescein-labeled probe
Mol. Mass.:2800.15
Organism:n/a
Description:n/a
Residue:25
Sequence:
FITC-QDASTKKLSECLKRIGDELDS