Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarboxypeptidase A1
LigandBDBM21489
Substrate/CompetitorBDBM21477
Meas. Tech.CPA Inhibition Assay
pH7.5±n/a
Temperature295.15±n/a K
IC50 27000±n/a nM
Citation Dales, NAGould, AEBrown, JACalderwood, EFGuan, BMinor, CAGavin, JMHales, PKaushik, VKStewart, MTummino, PJVickers, CSOcain, TDPatane, MA Substrate-based design of the first class of angiotensin-converting enzyme-related carboxypeptidase (ACE2) inhibitors. J Am Chem Soc124:11852-3 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Carboxypeptidase A1
Name:Carboxypeptidase A1
Synonyms:CPA1 | Carboxypeptidase A | Carboxypeptidase A (CPA) | Carboxypeptidase A1 precursor
Type:Enzyme
Mol. Mass.:47073.90
Organism:Bos taurus (bovine)
Description:From Sigma-Aldrich Co.
Residue:419
Sequence:
MQGLLILSVLLGAALGKEDFVGHQVLRITAADEAEVQTVKELEDLEHLQLDFWRGPGQPG
SPIDVRVPFPSLQAVKVFLEAHGIRYRIMIEDVQSLLDEEQEQMFASQSRARSTNTFNYA
TYHTLDEIYDFMDLLVAEHPQLVSKLQIGRSYEGRPIYVLKFSTGGSNRPAIWIDLGIHS
REWITQATGVWFAKKFTEDYGQDPSFTAILDSMDIFLEIVTNPDGFAFTHSQNRLWRKTR
SVTSSSLCVGVDANRNWDAGFGKAGASSSPCSETYHGKYANSEVEVKSIVDFVKDHGNFK
AFLSIHSYSQLLLYPYGYTTQSIPDKTELNQVAKSAVEALKSLYGTSYKYGSIITTIYQA
SGGSIDWSYNQGIKYSFTFELRDTGRYGFLLPASQIIPTAQETWLGVLTIMEHTLNNLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21489
NameBDBM21489
Synonyms:(2S)-2-{[(1S)-1-carboxy-2-{1-[(3,5-dichlorophenyl)methyl]-1H-imidazol-5-yl}ethyl]amino}-4-methylpentanoic acid | 2-(1-carboxy-2-(3-(3,5-dichlorobenzyl)-3H-imidazol-4-yl)ethylamino)-4-methylpentanoic acid | CHEMBL429844 | MLN 4760 | MLN-4760 | MLN4760
TypeSmall organic molecule
Emp. Form.C19H23Cl2N3O4
Mol. Mass.428.31
SMILESCC(C)C[C@H](N[C@@H](Cc1cncn1Cc1cc(Cl)cc(Cl)c1)C(O)=O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM21477
NameBDBM21477
Synonyms:(2S)-2-[(2S)-2-[(2E)-3-(furan-2-yl)prop-2-enamido]-3-phenylpropanamido]-3-phenylpropanoic acid | FAPP | Furyl-acryloyl-phe-phe | Furylacryloyl-Phe-Phe | N- (3- [2-furyl] acryloyl)-phe-phe
Typen/a
Emp. Form.C25H24N2O5
Mol. Mass.432.4685
SMILESOC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)\C=C\c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: