Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOrexin receptor type 1
LigandBDBM373172
Substrate/Competitorn/a
Meas. Tech.Cell-based Functional Assay
IC50 2.00±n/a nM
Citation Kamenecka, TMHe, YNguyen, WJiang, RSong, XHerr, RJJiang, Q Substituted prolines/piperidines as orexin receptor antagonists US Patent US9896452 Publication Date 2/20/2018
More Info.:Get all data from this article,  Assay Method
 
Orexin receptor type 1
Name:Orexin receptor type 1
Synonyms:Hypocretin receptor type 1 | Orexin receptor type 1 (OR 1) | Orexin receptor type 1 (OR-1) | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Orexin receptor type 1 (OxR1) | Ox1r
Type:Protein
Mol. Mass.:47554.50
Organism:Homo sapiens (Human)
Description:O43613
Residue:425
Sequence:
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM373172
NameBDBM373172
Synonyms:US9896452, Example 32 | rac-N-((1-(biphenylcarbonyl)-5-hydroxypiperidin-2-yl)methyl)quinoline-8-carboxamide
TypeSmall organic molecule
Emp. Form.C29H27N3O3
Mol. Mass.465.543
SMILESOC1CCC(CNC(=O)c2cccc3cccnc23)N(C1)C(=O)c1ccccc1-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a