Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 1 (S1P1)
LigandBDBM22202
Substrate/CompetitorBDBM22202
Meas. Tech.[32P] S1P Binding Assay
pH7.5±n/a
Temperature277.15±n/a K
Ki 1.2±0.04 nM
Citation Kiuchi, MAdachi, KTomatsu, AChino, MTakeda, STanaka, YMaeda, YSato, NMitsutomi, NSugahara, KChiba, K Asymmetric synthesis and biological evaluation of the enantiomeric isomers of the immunosuppressive FTY720-phosphate. Bioorg Med Chem13:425-32 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Sphingosine 1-phosphate receptor 1 (S1P1)
Name:Sphingosine 1-phosphate receptor 1 (S1P1)
Synonyms:Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1
Type:Enzyme
Mol. Mass.:42836.02
Organism:Homo sapiens (Human)
Description:P21453
Residue:382
Sequence:
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22202
NameBDBM22202
Synonyms:S1P | [32P]S1P | [33P]S1P | sphingosine-1-phosphate | sphingosine-1-phosphate, 32P labeled | sphingosine-1-phosphate, 33P labeled | {[(4Z)-2-amino-3-hydroxyoctadec-4-en-1-yl]oxy}phosphonic acid
Typeradiolabeled ligand
Emp. Form.C18H38NO5P
Mol. Mass.379.4718
SMILESCCCCCCCCCCCCC\C=C/C(O)C(N)COP(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM22202
NameBDBM22202
Synonyms:S1P | [32P]S1P | [33P]S1P | sphingosine-1-phosphate | sphingosine-1-phosphate, 32P labeled | sphingosine-1-phosphate, 33P labeled | {[(4Z)-2-amino-3-hydroxyoctadec-4-en-1-yl]oxy}phosphonic acid
Typeradiolabeled ligand
Emp. Form.C18H38NO5P
Mol. Mass.379.4718
SMILESCCCCCCCCCCCCC\C=C/C(O)C(N)COP(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: