Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-interacting serine/threonine-protein kinase 1
LigandBDBM375550
Substrate/Competitorn/a
Meas. Tech.In Vitro Kinase Assay
IC50<100.0±n/a nM
Citation Nacro, KDuraiswamy, AJChennamaneni, LR Bicyclic heterocyclic derivatives as MNK1 and MNK2 modulators and uses thereof US Patent US9908886 Publication Date 3/6/2018
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-interacting serine/threonine-protein kinase 1
Name:MAP kinase-interacting serine/threonine-protein kinase 1
Synonyms:MAP Kinase-Interacting Protein Kinase (MNK1) | MAP kinase signal-integrating kinase 1 | MAP kinase-interacting serine/threonine-protein kinase 1 (MnK1) | MAP kinase-interacting serine/threonine-protein kinase MNK1 | MAP-kinase interacting kinase 1 (MNK1) | MAPK signal-integrating kinase 1
Type:Serine/threonine-protein kinase
Mol. Mass.:51342.85
Organism:Homo sapiens (Human)
Description:Q9BUB5
Residue:465
Sequence:
MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAY
AKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRF
YLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPS
GLTAAPTSLGSSDPPTSASQVAGTTGIAHRDLKPENILCESPEKVSPVKICDFDLGSGMK
LNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKRCDLWSLGVVLYIMLSGYPP
FVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLVRDAK
QRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL
AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM375550
NameBDBM375550
Synonyms:4-(3-(4-cyanophenyl)imidazo[1,2-a]pyridin-6-yl)-N-methyl-N-(2-morpholino-2-oxoethyl)benzamide | US9908886, Example 101
TypeSmall organic molecule
Emp. Form.C28H25N5O3
Mol. Mass.479.5298
SMILESCN(CC(=O)N1CCOCC1)C(=O)c1ccc(cc1)-c1ccc2ncc(-c3ccc(cc3)C#N)n2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a