Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-interacting serine/threonine-protein kinase 1/2
LigandBDBM375605
Substrate/Competitorn/a
Meas. Tech.In Vitro Kinase Assay
IC50<100.0±n/a nM
Citation Nacro, KDuraiswamy, AJChennamaneni, LR Bicyclic heterocyclic derivatives as MNK1 and MNK2 modulators and uses thereof US Patent US9908886 Publication Date 3/6/2018
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-interacting serine/threonine-protein kinase 1/2
Name:MAP kinase-interacting serine/threonine-protein kinase 1/2
Synonyms:GPRK7 | MAP kinase signal-integrating kinase 2 | MAP kinase-interacting serine/threonine-protein kinase 2 (MKNK2) | MAP kinase-interacting serine/threonine-protein kinase 2 (MnK2) | MAP-kinase interacting kinase 2 (MNK2) | MKNK2 | MNK2
Type:Protein
Mol. Mass.:51870.79
Organism:Homo sapiens (Human)
Description:Q9HBH9
Residue:465
Sequence:
MVQKKPAELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAK
KRGKKKKRGRATDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPG
HIRSRVFREVEMLYQCQGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNEL
EASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFDLGSGIKLNGDCS
PISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGRCG
SDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLVRDAKQRLSAA
QVLQHPWVQGCAPENTLPTPMVLQRNSCAKDLTSFAAEAIAMNRQLAQHDEDLAEEEAAG
QGQPVLVRATSRCLQLSPPSQSKLAQRRQRASLSSAPVVLVGDHA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM375605
NameBDBM375605
Synonyms:N-(5-(3-(4-cyanophenyl)imidazo[1,2-a]pyridin-6-yl)-2-(4-(methylamino)piperidine-1-carbonyl)phenyl)acetamide | US9908886, Example 169
TypeSmall organic molecule
Emp. Form.C27H24N6O2
Mol. Mass.464.5185
SMILESCC(=O)Nc1cc(ccc1C(=O)N1CCNCC1)-c1ccc2ncc(-c3ccc(cc3)C#N)n2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a