Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBotulinum Neurotoxin Type A
LigandBDBM23295
Substrate/CompetitorSNAPtide
Meas. Tech.Evaluation of Inhibitors with Recombinant LC/A
pH7.4±n/a
Temperature296.15±n/a K
IC50 15000±n/a nM
Citation Capková, KYoneda, YDickerson, TJJanda, KD Synthesis and structure-activity relationships of second-generation hydroxamate botulinum neurotoxin A protease inhibitors. Bioorg Med Chem Lett17:6463-6 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Botulinum Neurotoxin Type A
Name:Botulinum Neurotoxin Type A
Synonyms:BoNT/A LC | Botulinum neurotoxin A light chain
Type:Metalloprotease
Mol. Mass.:48687.43
Organism:Clostridium botulinum
Description:Recombinant C. botulinum LC/A (1-425) was expressed in E. coli.
Residue:425
Sequence:
MPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLN
PPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGG
STIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHDVLNLTRNGY
GSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAEHRLYGIAINPN
RVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDVASTLNKA
KSIIGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVNFFKV
INRKTYLNFDKAVFRINIVPDENYTIKDGFNLKGANLSTNFNGQNTEINSRNFTRLKNFT
GLFEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23295
NameBDBM23295
Synonyms:(2E)-3-(4-chlorophenyl)-N-hydroxyprop-2-enamide | 4-chlorocinnamic hydroxamate, 1
TypeSmall organic molecule
Emp. Form.C9H8ClNO2
Mol. Mass.197.618
SMILESONC(=O)\C=C\c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
SNAPtide
Name:SNAPtide
Synonyms:n/a
Type:Fluorogenic Substrate
Mol. Mass.:358.43
Organism:n/a
Description:Peptide derived from synaptosomes associated protein, SNAP-25. (U.S. Patent #6504006. List Biological Laboratories, Inc., Campbell, CA.).
Residue:3
Sequence:
n/a