Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGuanylate cyclase soluble subunit alpha-1
LigandBDBM281739
Substrate/Competitorn/a
Meas. Tech.Stimulation of sGC Enzyme Activity
EC50 220±n/a nM
Citation Hahn, MLampe, TStasch, JSchlemmer, KWunder, FLi, VMBecker-Pelster, EStoll, FKnorr, AWoltering, E Branched 3-phenylpropionic acid derivatives and their use US Patent US10259776 Publication Date 4/16/2019
More Info.:Get all data from this article,  Assay Method
 
Guanylate cyclase soluble subunit alpha-1
Name:Guanylate cyclase soluble subunit alpha-1
Synonyms:GCS-alpha-1 | GCS-alpha-3 | GUC1A3 | GUCSA3 | GUCY1A1 | GUCY1A3 | Guanylate cyclase soluble (GCS-alpha-1) | Guanylate cyclase soluble subunit alpha-3 | Solube guanylate cyclase alpha-1 (sGC alpha-1) | Solube guanylate cyclase alpha-1 (sGCalpha) | soluble guanylate cyclase alpha-1 (sGC)
Type:Enzyme
Mol. Mass.:77457.21
Organism:Homo sapiens (Human)
Description:Q02108
Residue:690
Sequence:
MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAGSSESCKATVPICQDIPEKNIQESLP
QRKTSRSRVYLHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAE
QAVAAGVPVEVIKESLGEEVFKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCQEAG
KRGRLEDASILCLDKEDDFLHVYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLMPPCF
HNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQ
FGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRVRRWDNSVKKS
SRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR
AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNV
TMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHK
ESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNN
VTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAY
QQGTNSKPCFQKKDVEDGNANFLGKASGID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM281739
NameBDBM281739
Synonyms:US10023528, Example 25 | US10259776, Example 25
TypeSmall organic molecule
Emp. Form.C24H26Cl2F3NO4
Mol. Mass.520.369
SMILESCOC(C)(C)C(CC(O)=O)c1ccc(Cl)c(NC(=O)[C@@H]([C@@H](C)C(F)(F)F)c2ccc(Cl)cc2)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a